Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klkb1 Peptide - C-terminal region

Klkb1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Klk3, Kalp1, KALP15, MGC108748, Klkb1

UniProt

P14272

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Klkb1 Rabbit Polyclonal Antibody (orb579536) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036857

Preservative

Lyophilized powder

AA Sequence

GPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQSSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYT1 (N-term) Rabbit Polyclonal Antibody
AP52803PU-N 400 µL

MYT1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BPIFB3 Polyclonal Antibody
E-AB-12543-01 20 µL

BPIFB3 Polyclonal Antibody

Sign In for Pricing
View Details
BPIFB3 Polyclonal Antibody
E-AB-12543-02 60 µL

BPIFB3 Polyclonal Antibody

Sign In for Pricing
View Details
BPIFB3 Polyclonal Antibody
E-AB-12543-03 120 µL

BPIFB3 Polyclonal Antibody

Sign In for Pricing
View Details
BPIFB3 Polyclonal Antibody
E-AB-12543-04 200 µL

BPIFB3 Polyclonal Antibody

Sign In for Pricing
View Details
B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), 0.2mg/mL
BNUB1788-500 1x 500 µL

B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), 0.2mg/mL

Sign In for Pricing
View Details