Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLRC1 Peptide - C-terminal region

KLRC1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD159A, MGC13374, MGC59791, NKG2, NKG2A

UniProt

P26715

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLRC1 Rabbit Polyclonal Antibody (orb584970) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_015567

Preservative

Lyophilized powder

AA Sequence

SHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

53BP1 (TP53BP1) Rabbit Monoclonal Antibody
TA423061 100 µL

53BP1 (TP53BP1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
POM121C (NM_001099415) Human Over-expression Lysate
LY420452 100 µg

POM121C (NM_001099415) Human Over-expression Lysate

Sign In for Pricing
View Details
ST3GAL5 (NM_001042437) Human Over-expression Lysate
LC420902 20 µg

ST3GAL5 (NM_001042437) Human Over-expression Lysate

Sign In for Pricing
View Details
OR2T29 (NM_001004694) Human Over-expression Lysate
LY423882 100 µg

OR2T29 (NM_001004694) Human Over-expression Lysate

Sign In for Pricing
View Details
CBLIF Antibody
OC-620-01 50 μL

CBLIF Antibody

Sign In for Pricing
View Details
CBLIF Antibody
OC-620-02 100 µL

CBLIF Antibody

Sign In for Pricing
View Details