KLRC1 Peptide - C-terminal region
KLRC1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CD159A, MGC13374, MGC59791, NKG2, NKG2A
UniProt
P26715
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KLRC1 Rabbit Polyclonal Antibody (orb584970) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_015567
Preservative
Lyophilized powder
AA Sequence
SHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP51228PU-N 400 µL
Deformed Epidermal Autoregulatory Factor 1 (DEAF1) (C-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
SPD-C52H3-1g 1 g
SARS-CoV-2 (COVID-19) S protein RBD, His Tag (MALS verified)
Sign In for Pricing
View Details 
GMP-BM4H18-500ug 500 µg
GMP Human BMP-4 / BMP2B (improved sequence) Protein
Sign In for Pricing
View Details 