Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KPNB1 Peptide - N-terminal region

KPNB1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

IMB1, IPO1, IPOB, Impnb, MGC2155, MGC2156, MGC2157, NTF97

UniProt

Q14974

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KPNB1 Rabbit Polyclonal Antibody (orb331124) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002256

Preservative

Lyophilized powder

AA Sequence

EHMKESTLEAIGYICQDIDPEQLQDKSNEILTAIIQGMRKEEPSNNVKLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LANCL2 (NM_018697) Human Recombinant Protein
TP309751 20 µg

LANCL2 (NM_018697) Human Recombinant Protein

Sign In for Pricing
View Details
ARID1A Human Knockdown Lysate
LY300053 100 µg

ARID1A Human Knockdown Lysate

Sign In for Pricing
View Details
NMDAR1 (Ab-897) Antibody
8B7174-AAT 50 µg

NMDAR1 (Ab-897) Antibody

Sign In for Pricing
View Details
Lepr (LepRb / OBRb) Chicken Polyclonal Antibody
CH14104-100 100 µL

Lepr (LepRb / OBRb) Chicken Polyclonal Antibody

Sign In for Pricing
View Details
Human SLC13A4 activation kit by CRISPRa
GA108829 1 Kit

Human SLC13A4 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR559878 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details