Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KPNB1 Peptide - N-terminal region

KPNB1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

IMB1, IPO1, IPOB, Impnb, MGC2155, MGC2156, MGC2157, NTF97

UniProt

Q14974

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KPNB1 Rabbit Polyclonal Antibody (orb331124) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002256

Preservative

Lyophilized powder

AA Sequence

EHMKESTLEAIGYICQDIDPEQLQDKSNEILTAIIQGMRKEEPSNNVKLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Myeloid tissue
CS627746 5x 5 µm

Frozen Tissue Sections, Myeloid tissue

Sign In for Pricing
View Details
rac-1-Palmitoyl-2-linolenoyl-3-chloropropanediol-d5
TRC-P158852-25MG 25 mg

rac-1-Palmitoyl-2-linolenoyl-3-chloropropanediol-d5

Sign In for Pricing
View Details
Destrin (DSTN) (NM_001011546) Human Over-expression Lysate
LY423272 100 µg

Destrin (DSTN) (NM_001011546) Human Over-expression Lysate

Sign In for Pricing
View Details
Ɑ-Methoxy-ω-Pyridyldithio PEG
12750-44.5G 5 g

Ɑ-Methoxy-ω-Pyridyldithio PEG

Sign In for Pricing
View Details
Cystatin A (CPTC-CSTA-1), 0.2mg/mL
BNUB2236-100 1x 100 µL

Cystatin A (CPTC-CSTA-1), 0.2mg/mL

Sign In for Pricing
View Details
WT1 (Wilm's Tumor 1) (6F-H2), CF488A conjugate, 0.1mg/mL
BNC880856-500 1x 500 µL

WT1 (Wilm's Tumor 1) (6F-H2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details