Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KPNB1 Peptide - N-terminal region

KPNB1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

IMB1, IPO1, IPOB, Impnb, MGC2155, MGC2156, MGC2157, NTF97

UniProt

Q14974

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KPNB1 Rabbit Polyclonal Antibody (orb331124) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002256

Preservative

Lyophilized powder

AA Sequence

EHMKESTLEAIGYICQDIDPEQLQDKSNEILTAIIQGMRKEEPSNNVKLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRHR Antibody
8G954-AAT 50 µg

TRHR Antibody

Sign In for Pricing
View Details
Spiroxamine
TRC-S683500-1G 1 g

Spiroxamine

Sign In for Pricing
View Details
CD62L (L-Selectin) (CD62L/1588), CF568 conjugate, 0.1mg/mL
BNC681588-500 1x 500 µL

CD62L (L-Selectin) (CD62L/1588), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Proopiomelanocortin (POMC) ELISA Kit
RDR-POMC-Hu-01 96 Tests

Human Proopiomelanocortin (POMC) ELISA Kit

Sign In for Pricing
View Details
Human Proopiomelanocortin (POMC) ELISA Kit
RDR-POMC-Hu-02 48 Tests

Human Proopiomelanocortin (POMC) ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Soft tissue
CS643915 5x 5 µm

Frozen Tissue Sections, Soft tissue

Sign In for Pricing
View Details