Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kras Peptide - N-terminal region

Kras Peptide - N-terminal region

Product Specifications

Product Name Alternative

Kras2, c-Ki-ras, p21

UniProt

A0JN17

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Kras Rabbit Polyclonal Antibody (orb582746) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113703

Preservative

Lyophilized powder

AA Sequence

QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WIPI2 (2A2), 1mg/mL
BNUM2904-50 1x 50 µL

WIPI2 (2A2), 1mg/mL

Sign In for Pricing
View Details
CF®725 Tyramide
#96128 1x 0.5 mg

CF®725 Tyramide

Sign In for Pricing
View Details
FBXW7 Rabbit Polyclonal Antibody
TA369030 100 µL

FBXW7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
3-Furaldehyde
TRC-F863200-1G 1 g

3-Furaldehyde

Sign In for Pricing
View Details
FMOC-Asp (5/6-TAMRA) -OH
5005-AAT 100 mg

FMOC-Asp (5/6-TAMRA) -OH

Sign In for Pricing
View Details
ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2035), CF405S conjugate, 0.1mg/mL
BNC042035-500 1x 500 µL

ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2035), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details