Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kras Peptide - N-terminal region

Kras Peptide - N-terminal region

Product Specifications

Product Name Alternative

Kras2, c-Ki-ras, p21

UniProt

A0JN17

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Kras Rabbit Polyclonal Antibody (orb582746) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113703

Preservative

Lyophilized powder

AA Sequence

QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD105 Antibody (Biotin)
KB-26096-01 50 μL

CD105 Antibody (Biotin)

Sign In for Pricing
View Details
CD105 Antibody (Biotin)
KB-26096-02 100 µL

CD105 Antibody (Biotin)

Sign In for Pricing
View Details
CD105 Antibody (Biotin)
KB-26096-03 1 mL

CD105 Antibody (Biotin)

Sign In for Pricing
View Details
FoxP1 Rabbit Polyclonal Antibody
ER1901-26 100 µL

FoxP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DOG-1 (DOG1.1), CF647 conjugate, 0.1mg/mL
BNC470725-100 1x 100 µL

DOG-1 (DOG1.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Diisopropyl Phosphorochloridate
TRC-D459400-25G 25 g

Diisopropyl Phosphorochloridate

Sign In for Pricing
View Details