Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT36 Peptide - N-terminal region

KRT36 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HA6, KRTHA6, hHa6

UniProt

O76013

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT36 Rabbit Polyclonal Antibody (orb584934) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003762

Preservative

Lyophilized powder

AA Sequence

IEDFQQKILLTKSENARLVLQIDNAKLAADDFRTKYETELSLRQLVEADI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL32 (NM_000994) Human 3' UTR Clone
SC212882 10 µg

RPL32 (NM_000994) Human 3' UTR Clone

Sign In for Pricing
View Details
Compound NP-000612
T131088-01 10 mg

Compound NP-000612

Sign In for Pricing
View Details
Compound NP-000612
T131088-02 1 g

Compound NP-000612

Sign In for Pricing
View Details
Compound NP-000612
T131088-03 1 mg

Compound NP-000612

Sign In for Pricing
View Details
Compound NP-000612
T131088-04 50 mg

Compound NP-000612

Sign In for Pricing
View Details
Compound NP-000612
T131088-05 5 mg

Compound NP-000612

Sign In for Pricing
View Details