Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT36 Peptide - N-terminal region

KRT36 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HA6, KRTHA6, hHa6

UniProt

O76013

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT36 Rabbit Polyclonal Antibody (orb584934) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003762

Preservative

Lyophilized powder

AA Sequence

IEDFQQKILLTKSENARLVLQIDNAKLAADDFRTKYETELSLRQLVEADI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLX Antibody - C-terminal region
ARP39967_P050-25UL 25 µL

MLX Antibody - C-terminal region

Sign In for Pricing
View Details
CFH Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-54051R-BF680-01 20 µL

CFH Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
CFH Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-54051R-BF680-02 100 µL

CFH Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Phospho-NFKB p65 (Ser281) Polyclonal Antibody, Cy5.5 Conjugated
bs-17502R-Cy5.5 100 µL

Phospho-NFKB p65 (Ser281) Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Anti-EIF1AY antibody
PAab02687 100 µg

Anti-EIF1AY antibody

Sign In for Pricing
View Details
Recombinant Shigella Boydii ybiA Protein (aa 1-160)
VAng-Lsx09457-50gEcoli 50 µg (E. coli)

Recombinant Shigella Boydii ybiA Protein (aa 1-160)

Sign In for Pricing
View Details