Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

L3mbtl Peptide - middle region

L3mbtl Peptide - middle region

Product Specifications

Product Name Alternative

C630004G01, KIAA0681, L3MBTL1, mKIAA0681, L3mbtl

UniProt

A2A5N8

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with L3mbtl Rabbit Polyclonal Antibody (orb576368) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_485097

Preservative

Lyophilized powder

AA Sequence

KVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKLHFDGWSHNYD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amfenac Sodium Hydrate
TRC-A576500-50MG 50 mg

Amfenac Sodium Hydrate

Sign In for Pricing
View Details
PDPN Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7B4]
TA811746AM 100 µL

PDPN Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7B4]

Sign In for Pricing
View Details
Recombinant Human Notch2 (C-6His)
PKSH034023-01 10 µg

Recombinant Human Notch2 (C-6His)

Sign In for Pricing
View Details
Recombinant Human Notch2 (C-6His)
PKSH034023-02 50 µg

Recombinant Human Notch2 (C-6His)

Sign In for Pricing
View Details
Abcc9 Mouse Gene Knockout Kit (CRISPR)
KN500630 1 Kit

Abcc9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS700239 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details