Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

L3mbtl Peptide - middle region

L3mbtl Peptide - middle region

Product Specifications

Product Name Alternative

C630004G01, KIAA0681, L3MBTL1, mKIAA0681, L3mbtl

UniProt

A2A5N8

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with L3mbtl Rabbit Polyclonal Antibody (orb576368) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_485097

Preservative

Lyophilized powder

AA Sequence

KVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKLHFDGWSHNYD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse F8 (Coagulation Factor VIII) CLIA Kit
E-CL-M0206-01 24 Tests

Mouse F8 (Coagulation Factor VIII) CLIA Kit

Sign In for Pricing
View Details
Mouse F8 (Coagulation Factor VIII) CLIA Kit
E-CL-M0206-02 48 Tests

Mouse F8 (Coagulation Factor VIII) CLIA Kit

Sign In for Pricing
View Details
Mouse F8 (Coagulation Factor VIII) CLIA Kit
E-CL-M0206-03 96 Tests

Mouse F8 (Coagulation Factor VIII) CLIA Kit

Sign In for Pricing
View Details
Actb Mouse Gene Knockout Kit (CRISPR)
KN500772 1 Kit

Actb Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PCDH20 (NM_022843) Human Over-expression Lysate
LY432406 100 µg

PCDH20 (NM_022843) Human Over-expression Lysate

Sign In for Pricing
View Details
MYBBP1A Recombinant Rabbit Monoclonal Antibody [JB40-09]
ET7107-67 100 µL

MYBBP1A Recombinant Rabbit Monoclonal Antibody [JB40-09]

Sign In for Pricing
View Details