Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

L3mbtl Peptide - middle region

L3mbtl Peptide - middle region

Product Specifications

Product Name Alternative

C630004G01, KIAA0681, L3MBTL1, mKIAA0681, L3mbtl

UniProt

A2A5N8

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with L3mbtl Rabbit Polyclonal Antibody (orb576369) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_900202

Preservative

Lyophilized powder

AA Sequence

LKPMKKRKHKEYQSPSEESEPEAVKQGEGKDAEREPTPSTPENEEWSRSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ces3a sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4267304 1.0 µg DNA

Ces3a sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Murlentamab MMAE
T9901A-211-01 1 mg

Murlentamab MMAE

Sign In for Pricing
View Details
Murlentamab MMAE
T9901A-211-02 5 mg

Murlentamab MMAE

Sign In for Pricing
View Details
Duck Lipin 1 ELISA Kit
MBS096804 Inquire

Duck Lipin 1 ELISA Kit

Sign In for Pricing
View Details
NELF-B siRNA (h)
sc-75896 10 µM

NELF-B siRNA (h)

Sign In for Pricing
View Details
Smarcb1 3'UTR Lenti-reporter-Luc Vector
44413084 1.0 µg

Smarcb1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details