L3MBTL3 Peptide - N-terminal region
L3MBTL3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
MBT-1, MBT1, RP11-73O6.1
UniProt
Q08DF3
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with L3MBTL3 Rabbit Polyclonal Antibody (orb581191) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001007103
Preservative
Lyophilized powder
AA Sequence
MTESASSTSGQEFDVFSVMDWKDGVGTLPGSDLKFRVNEFGALEVITDEN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680391-500 1x 500 µL
CD81 / TAPA-1 (1.3.3.22), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470029-100 1x 100 µL
Fibronectin (TV-1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740177-500 1x 500 µL
CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740253-500 1x 500 µL
Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details