Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAMA4 Peptide - C-terminal region

LAMA4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp686D23145, LAMA3, LAMA4*-1

UniProt

Q16363

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LAMA4 Rabbit Polyclonal Antibody (orb330762) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001098679

Preservative

Lyophilized powder

AA Sequence

HCHPAGAPAPPRAVPHSSFSLSPPLSSPQCLESFTWARSVRKLEIKSFPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat GJA1 siRNA
abx917916-01 15 nmol

Rat GJA1 siRNA

Sign In for Pricing
View Details
Rat GJA1 siRNA
abx917916-02 30 nmol

Rat GJA1 siRNA

Sign In for Pricing
View Details
Septin 3 (SEPT3) (NM_145733) Human Tagged ORF Clone Lentiviral Particle
RC215771L3V 200 µL

Septin 3 (SEPT3) (NM_145733) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
VC1kb DNA Ladder (ready-to-use), 5 x 50µg
NL1412 5 x 50μg

VC1kb DNA Ladder (ready-to-use), 5 x 50µg

Sign In for Pricing
View Details
ODF3L1 Rabbit pAb, Pacific Blue conjugated
orb2855233 100 µL

ODF3L1 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Mouse Monoclonal PLA2G16/HRASLS3 Antibody (OTI1A5) [DyLight 650]
NBP2-73454C 0.1 mL

Mouse Monoclonal PLA2G16/HRASLS3 Antibody (OTI1A5) [DyLight 650]

Sign In for Pricing
View Details