LAMA4 Peptide - C-terminal region
LAMA4 Peptide - C-terminal region
Product Specifications
Product Name Alternative
DKFZp686D23145, LAMA3, LAMA4*-1
UniProt
Q16363
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LAMA4 Rabbit Polyclonal Antibody (orb330762) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001098679
Preservative
Lyophilized powder
AA Sequence
HCHPAGAPAPPRAVPHSSFSLSPPLSSPQCLESFTWARSVRKLEIKSFPL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7013116-01 0.02 mg
Recombinant Oryza sativa subsp. japonica Putative xyloglucan glycosyltransferase 10 (CSLC10)
Sign In for Pricing
View Details MBS7013116-02 0.1 mg
Recombinant Oryza sativa subsp. japonica Putative xyloglucan glycosyltransferase 10 (CSLC10)
Sign In for Pricing
View Details MBS7013116-03 5x 0.1 mg
Recombinant Oryza sativa subsp. japonica Putative xyloglucan glycosyltransferase 10 (CSLC10)
Sign In for Pricing
View Details 
