Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAMP1 Peptide - N-terminal region

LAMP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD107a, LAMPA, LGP120

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LAMP1 Rabbit Polyclonal Antibody (orb584161) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

AAF66141

Preservative

Lyophilized powder

AA Sequence

NMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR4C13 (NM_001001955) Human Tagged Lenti ORF Clone
RC217434L3 10 µg

OR4C13 (NM_001001955) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
LAPTM4B (NM_018407) Human Over-expression Lysate
LH10735V 100 µg

LAPTM4B (NM_018407) Human Over-expression Lysate

Sign In for Pricing
View Details
LY75/CD205 Protein, Mouse, Recombinant (C-His)
E51P01511 100 µg

LY75/CD205 Protein, Mouse, Recombinant (C-His)

Sign In for Pricing
View Details
ABLIM2 (NM_001130085) Human Tagged ORF Clone
RC225968 10 µg

ABLIM2 (NM_001130085) Human Tagged ORF Clone

Sign In for Pricing
View Details
Miz1/ZNF60 Polyclonal Antibody
MBS9234004-01 0.1 mL

Miz1/ZNF60 Polyclonal Antibody

Sign In for Pricing
View Details
Miz1/ZNF60 Polyclonal Antibody
MBS9234004-02 5x 0.1 mL

Miz1/ZNF60 Polyclonal Antibody

Sign In for Pricing
View Details