Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAMP1 Peptide - N-terminal region

LAMP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD107a, LAMPA, LGP120

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LAMP1 Rabbit Polyclonal Antibody (orb584161) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

AAF66141

Preservative

Lyophilized powder

AA Sequence

NMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Cytokeratin pan Antibody (SPM115 + SPM116) [PerCP]
NBP2-34394PCP 0.1 mL

Mouse Monoclonal Cytokeratin pan Antibody (SPM115 + SPM116) [PerCP]

Sign In for Pricing
View Details
Hsa-miR-632 miRNA Mimic
orb1878346-01 5 nmol

Hsa-miR-632 miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-632 miRNA Mimic
orb1878346-02 10 nmol

Hsa-miR-632 miRNA Mimic

Sign In for Pricing
View Details
VGLL4 Protein Vector (Human) (pPM-C-His)
PV045764 500 ng

VGLL4 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
RNU1-15P ORF Vector (Human) (pORF)
40347011 1.0 µg DNA

RNU1-15P ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Factor IX Antibody
E38PA7508 100 µL

Factor IX Antibody

Sign In for Pricing
View Details