Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LANCL3 Peptide - C-terminal region

LANCL3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ42925

UniProt

Q6ZV70

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LANCL3 Rabbit Polyclonal Antibody (orb582930) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_940913

Preservative

Lyophilized powder

AA Sequence

ICHGVAGSAYVFLLLYRLTGNSKYIYRAQSSFPVNLIKMEHLLYTRQHCF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YDJC Protein Lysate
OCOA16181-20UG 20 µg

YDJC Protein Lysate

Sign In for Pricing
View Details
Lentiviral mouse Vmn1r177 shRNA (UAS) - Lentiviral mouseVmn1r177 shRNA (UAS, GFP) (25)
GTR15226088 1 Vial

Lentiviral mouse Vmn1r177 shRNA (UAS) - Lentiviral mouseVmn1r177 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
TIP30 (HTATIP2) Human Over-expression Lysate
orb1364495 20 µg

TIP30 (HTATIP2) Human Over-expression Lysate

Sign In for Pricing
View Details
RAD23B antibody
70R-50301 100 µL

RAD23B antibody

Sign In for Pricing
View Details
4930447A16Rik 3'UTR Luciferase Stable Cell Line
TU100689 1.0 mL

4930447A16Rik 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Glucose Standard, 400mg/mL, 4g/L
22070146-1 250 mL

Glucose Standard, 400mg/mL, 4g/L

Sign In for Pricing
View Details