Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LANCL3 Peptide - C-terminal region

LANCL3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ42925

UniProt

Q6ZV70

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LANCL3 Rabbit Polyclonal Antibody (orb582930) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_940913

Preservative

Lyophilized powder

AA Sequence

ICHGVAGSAYVFLLLYRLTGNSKYIYRAQSSFPVNLIKMEHLLYTRQHCF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

V-ATPase B1 Lentiviral Activation Particles (h)
sc-400926-LAC 200 µL

V-ATPase B1 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Phospho-GluR1 (Thr840) Rabbit Polyclonal Antibody (BF750)
orb2524920 100 µL

Phospho-GluR1 (Thr840) Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
JUN Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
25270066 1.0 µg DNA

JUN Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Plant (Mouse-ear cress) superoxide dismutase [Cu-Zn]2, chloroplastic (CSD2) Elisa Kit
EK799007 96 Well

Plant (Mouse-ear cress) superoxide dismutase [Cu-Zn]2, chloroplastic (CSD2) Elisa Kit

Sign In for Pricing
View Details
E4 (NC_001693) Virus Tagged ORF Clone
VC101982 10 µg

E4 (NC_001693) Virus Tagged ORF Clone

Sign In for Pricing
View Details
MICALL2/JRAB Rabbit Polyclonal Antibody (PE)
orb492306 100 µL

MICALL2/JRAB Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details