Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LARP1 Peptide - N-terminal region

LARP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KIAA0731, LARP, MGC19556

UniProt

Q6PKG0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LARP1 Rabbit Polyclonal Antibody (orb577894) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_291029

Preservative

Lyophilized powder

AA Sequence

MATQVEPLLPGGATLLQAEEHGGLVRKKPPPAPEGKGEPGPNDVRGGEPD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plasma Cell Marker (LIV3G11, same as 7B18), CF647 conjugate, 0.1mg/mL
BNC470047-100 1x 100 µL

Plasma Cell Marker (LIV3G11, same as 7B18), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Hexametazidine
TRC-H291150-250MG 250 mg

Hexametazidine

Sign In for Pricing
View Details
Ramifenazone Hydrochloride Salt
TRC-R110500-10MG 10 mg

Ramifenazone Hydrochloride Salt

Sign In for Pricing
View Details
Oleyl Acetate
TRC-O532990-250MG 250 mg

Oleyl Acetate

Sign In for Pricing
View Details
SARS-CoV-2 Spike RBD Protein, His Tag (CH.1.1/Omicron) (MALS verified)
SPD-C5244-100ug 100 µg

SARS-CoV-2 Spike RBD Protein, His Tag (CH.1.1/Omicron) (MALS verified)

Sign In for Pricing
View Details
Mouse Peripherin (PRPH) ELISA Kit
RDR-PRPH-Mu-01 96 Tests

Mouse Peripherin (PRPH) ELISA Kit

Sign In for Pricing
View Details