Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LARP1 Peptide - N-terminal region

LARP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KIAA0731, LARP, MGC19556

UniProt

Q6PKG0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LARP1 Rabbit Polyclonal Antibody (orb577894) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_291029

Preservative

Lyophilized powder

AA Sequence

MATQVEPLLPGGATLLQAEEHGGLVRKKPPPAPEGKGEPGPNDVRGGEPD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-(6-(6-Aminohexanamido)hexanamido)hexanoic Acid
TRC-A618823-250MG 250 mg

6-(6-(6-Aminohexanamido)hexanamido)hexanoic Acid

Sign In for Pricing
View Details
Cardboard Freezer Boxes
R2781-R 5 Units/Pack

Cardboard Freezer Boxes

Sign In for Pricing
View Details
Optitrol NAT SARS-CoV-2
NT04031 5x 0.6 mL

Optitrol NAT SARS-CoV-2

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human IgM,  5nm
GM-08-5 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgM, 5nm

Sign In for Pricing
View Details
1,2-Distearoyl-sn-glycero-3-phosphoethanolamine
TRC-D493610-500MG 500 mg

1,2-Distearoyl-sn-glycero-3-phosphoethanolamine

Sign In for Pricing
View Details
CD22 / BL-CAM (B-Cell Marker) (BLCAM/1796), CF594 conjugate, 0.1mg/mL
BNC941796-500 1x 500 µL

CD22 / BL-CAM (B-Cell Marker) (BLCAM/1796), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details