Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAX1 Peptide - C-terminal region

LAX1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ20340, LAX

UniProt

B7Z744

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LAX1 Rabbit Polyclonal Antibody (orb331019) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001129662

Preservative

Lyophilized powder

AA Sequence

ADFQPFTQSEDSQMKHREEMSNEDSSDYENVLTAKLGGRDSEQGPGTQLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromogranin A (CHGA/413), CF594 conjugate, 0.1mg/mL
BNC940413-100 1x 100 µL

Chromogranin A (CHGA/413), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EEF1B2 Human Gene Knockout Kit (CRISPR)
KN400733 1 Kit

EEF1B2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
gamma Actin (ACTG1) (NM_001614) Human Over-expression Lysate
LC419842 20 µg

gamma Actin (ACTG1) (NM_001614) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant CCR7 Monoclonal Antibody
AN301736L-01 50 µL

Recombinant CCR7 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant CCR7 Monoclonal Antibody
AN301736L-02 100 µL

Recombinant CCR7 Monoclonal Antibody

Sign In for Pricing
View Details
SPATA18 (NM_145263) Human Recombinant Protein
TP305544L 1 mg

SPATA18 (NM_145263) Human Recombinant Protein

Sign In for Pricing
View Details