Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LCOR Peptide - C-terminal region

LCOR Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ38026, KIAA1795, MLR2, RP11-175O19.1

UniProt

Q96JN0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LCOR Rabbit Polyclonal Antibody (orb584480) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115816

Preservative

Lyophilized powder

AA Sequence

EGDPGSKQPRKKRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse SID1 transmembrane family member 1, SIDT1 ELISA Kit
MBS9324133-01 48 Well

Mouse SID1 transmembrane family member 1, SIDT1 ELISA Kit

Sign In for Pricing
View Details
Mouse SID1 transmembrane family member 1, SIDT1 ELISA Kit
MBS9324133-02 96 Well

Mouse SID1 transmembrane family member 1, SIDT1 ELISA Kit

Sign In for Pricing
View Details
Mouse SID1 transmembrane family member 1, SIDT1 ELISA Kit
MBS9324133-03 5x 96 Well

Mouse SID1 transmembrane family member 1, SIDT1 ELISA Kit

Sign In for Pricing
View Details
Mouse SID1 transmembrane family member 1, SIDT1 ELISA Kit
MBS9324133-04 10x 96 Well

Mouse SID1 transmembrane family member 1, SIDT1 ELISA Kit

Sign In for Pricing
View Details
Anti-HSD11B1 Antibody Picoband®, PE Conjugate
A01565-PE 100 µg/Vial

Anti-HSD11B1 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
CDYL Blocking Peptide
33R-10137 100 ug

CDYL Blocking Peptide

Sign In for Pricing
View Details