Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lcorl Peptide - middle region

Lcorl Peptide - middle region

Product Specifications

Product Name Alternative

Mlr1

UniProt

Q3U285

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lcorl Rabbit Polyclonal Antibody (orb577447) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_742165

Preservative

Lyophilized powder

AA Sequence

LTLQKMVTQFKEKNESLQYETSNPPVQLKIPQLRVNSVSKSQADGSGLLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNU6-48 CRISPR All-in-one AAV vector set (with saCas9)(Human)
40471151 3x 1.0 µg DNA

RNU6-48 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Palmitoyl tripeptide-38
T80027-01 5 mg

Palmitoyl tripeptide-38

Sign In for Pricing
View Details
Palmitoyl tripeptide-38
T80027-02 50 mg

Palmitoyl tripeptide-38

Sign In for Pricing
View Details
Terazocin HCl
abx076677-01 20 mg

Terazocin HCl

Sign In for Pricing
View Details
Terazocin HCl
abx076677-02 100 mg

Terazocin HCl

Sign In for Pricing
View Details
WDR1 Protein Vector (Rat) (pPB-C-His)
PV316282 500 ng

WDR1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details