Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lcorl Peptide - middle region

Lcorl Peptide - middle region

Product Specifications

Product Name Alternative

Mlr1

UniProt

Q3U285

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lcorl Rabbit Polyclonal Antibody (orb577447) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_742165

Preservative

Lyophilized powder

AA Sequence

LTLQKMVTQFKEKNESLQYETSNPPVQLKIPQLRVNSVSKSQADGSGLLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trx-2 CRISPR Activation Plasmid (h2)
sc-402209-ACT-2 20 µg

Trx-2 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
PPARGC1B Polyclonal Antibody
E917258 100 µL

PPARGC1B Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Arf1 shRNA (UAS) - Lentiviral mouse Arf1 shRNA (UAS, iRFP) plasmid
GTR15174724 1 Vial

Lentiviral mouse Arf1 shRNA (UAS) - Lentiviral mouse Arf1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
6-Phenoxypyridine-3-carboximidamide hydrochloride
WYB72577-01 100 mg

6-Phenoxypyridine-3-carboximidamide hydrochloride

Sign In for Pricing
View Details
6-Phenoxypyridine-3-carboximidamide hydrochloride
WYB72577-02 1 g

6-Phenoxypyridine-3-carboximidamide hydrochloride

Sign In for Pricing
View Details
BPIFB2 siRNA (Mouse)
CRM6697-01 15 nmol

BPIFB2 siRNA (Mouse)

Sign In for Pricing
View Details