Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LDHAL6A Peptide - C-terminal region

LDHAL6A Peptide - C-terminal region

Product Specifications

Product Name Alternative

LDH6A, MGC23940

UniProt

Q6ZMR3

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LDHAL6A Rabbit Polyclonal Antibody (orb585538) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659409

Preservative

Lyophilized powder

AA Sequence

CHGLILGEHGDSSVPVWSGVNIAGVPLKDLNPDIGTDKDPEQWENVHKKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDKL5 Protein (N-GST, Human)
P523252 100 µg

CDKL5 Protein (N-GST, Human)

Sign In for Pricing
View Details
LINGO4 Rabbit Polyclonal Antibody (BF750)
orb2540045 100 µL

LINGO4 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Tissue Genomic DNA, Lung
CD563844 5 µg

Tissue Genomic DNA, Lung

Sign In for Pricing
View Details
PH Buff Sol 1.09 +/- 0.03 at 25C DIN19267
10109-01 500 mL

PH Buff Sol 1.09 +/- 0.03 at 25C DIN19267

Sign In for Pricing
View Details
PH Buff Sol 1.09 +/- 0.03 at 25C DIN19267
10109-02 1 L

PH Buff Sol 1.09 +/- 0.03 at 25C DIN19267

Sign In for Pricing
View Details
F9 (Coagulation Factor IX, Christmas Factor, Plasma Thromboplastin Component, PTC) (AP) discontinued
126543-AP 100 µL

F9 (Coagulation Factor IX, Christmas Factor, Plasma Thromboplastin Component, PTC) (AP) discontinued

Sign In for Pricing
View Details