Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LDHAL6A Peptide - C-terminal region

LDHAL6A Peptide - C-terminal region

Product Specifications

Product Name Alternative

LDH6A, MGC23940

UniProt

Q6ZMR3

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LDHAL6A Rabbit Polyclonal Antibody (orb585538) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659409

Preservative

Lyophilized powder

AA Sequence

CHGLILGEHGDSSVPVWSGVNIAGVPLKDLNPDIGTDKDPEQWENVHKKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH8A1 Antibody
orb676725 100 µL

ALDH8A1 Antibody

Sign In for Pricing
View Details
Methyl 1-boc-6-amino-indole-2-carboxylate
ZRB67782-01 1000 mg

Methyl 1-boc-6-amino-indole-2-carboxylate

Sign In for Pricing
View Details
Methyl 1-boc-6-amino-indole-2-carboxylate
ZRB67782-02 5000 mg

Methyl 1-boc-6-amino-indole-2-carboxylate

Sign In for Pricing
View Details
FITC*Polyclonal   Goat  Anti-Chicken IgY (IgG)(h+l)
C030635-1ml 1ml

FITC*Polyclonal Goat Anti-Chicken IgY (IgG)(h+l)

Sign In for Pricing
View Details
Sheep Polyclonal Fetal Hemoglobin Antibody [Alexa Fluor 488]
NB110-41084AF488 1 mL

Sheep Polyclonal Fetal Hemoglobin Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Hsa-miR-6834-3p mimic
HY-R02232-01 5 nmol

Hsa-miR-6834-3p mimic

Sign In for Pricing
View Details