Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LDHAL6A Peptide - C-terminal region

LDHAL6A Peptide - C-terminal region

Product Specifications

Product Name Alternative

LDH6A, MGC23940

UniProt

Q6ZMR3

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LDHAL6A Rabbit Polyclonal Antibody (orb585538) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659409

Preservative

Lyophilized powder

AA Sequence

CHGLILGEHGDSSVPVWSGVNIAGVPLKDLNPDIGTDKDPEQWENVHKKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MKX ORF Vector (Human) (pORF)
30183011 1.0 µg DNA

MKX ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
STRADB Polyclonal Antibody
A70653-050 50 µL

STRADB Polyclonal Antibody

Sign In for Pricing
View Details
Tmed5 sgRNA CRISPR Lentivector set (Rat)
K7417701 3x 1.0 µg

Tmed5 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
POMT2, CT (POMT2, Protein O-mannosyl-transferase 2, Dolichyl-phosphate-mannose-protein mannosyltransferase 2) (MaxLight 405)
MBS6335856-01 0.1 mL

POMT2, CT (POMT2, Protein O-mannosyl-transferase 2, Dolichyl-phosphate-mannose-protein mannosyltransferase 2) (MaxLight 405)

Sign In for Pricing
View Details
POMT2, CT (POMT2, Protein O-mannosyl-transferase 2, Dolichyl-phosphate-mannose-protein mannosyltransferase 2) (MaxLight 405)
MBS6335856-02 5x 0.1 mL

POMT2, CT (POMT2, Protein O-mannosyl-transferase 2, Dolichyl-phosphate-mannose-protein mannosyltransferase 2) (MaxLight 405)

Sign In for Pricing
View Details
Recombinant Exoribonuclease 1 (ERI1)
MBS2034118-01 0.01 mg

Recombinant Exoribonuclease 1 (ERI1)

Sign In for Pricing
View Details