Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LGALS13 Peptide - N-terminal region

LGALS13 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GAL13, PLAC8, PP13

UniProt

Q9UHV8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_037400

Preservative

Lyophilized powder

AA Sequence

AFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RITA (RITA1) activation kit by CRISPRa
GA113779 1 Kit

Human RITA (RITA1) activation kit by CRISPRa

Sign In for Pricing
View Details
Hypk (NM_026318) Mouse Tagged ORF Clone
MG200713 10 µg

Hypk (NM_026318) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
BOC Antibody
KC-3420-01 50 μL

BOC Antibody

Sign In for Pricing
View Details
BOC Antibody
KC-3420-02 100 µL

BOC Antibody

Sign In for Pricing
View Details
BOC Antibody
KC-3420-03 1 mL

BOC Antibody

Sign In for Pricing
View Details
C9orf171 (CFAP77) (NM_207417) Human Over-expression Lysate
LY404021 100 µg

C9orf171 (CFAP77) (NM_207417) Human Over-expression Lysate

Sign In for Pricing
View Details