Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lgals4 Peptide - C-terminal region

Lgals4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Galectin-4, gal-4

UniProt

Q8K419

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lgals4 Rabbit Polyclonal Antibody (orb578411) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034836

Preservative

Lyophilized powder

AA Sequence

VGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIP5 (E-6) Alexa Fluor® 680
sc-374487 AF680 200 µg/mL

RIP5 (E-6) Alexa Fluor® 680

Sign In for Pricing
View Details
ATP6V0B Protein Vector (Human) (pPB-His-GST)
PV325379 500 ng

ATP6V0B Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
N-Acetylglucosamine Kinase, NT (N-acetyl-D-glucosamine Kinase, NAGK, GlcNAc Kinase, GNK, HSA242910) (Azide free) (HRP) discontinued
A0528-21N-HRP 200 µL

N-Acetylglucosamine Kinase, NT (N-acetyl-D-glucosamine Kinase, NAGK, GlcNAc Kinase, GNK, HSA242910) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Recombinant Human N6AMT2 Protein - (Dry Ice)
H00221143-P01-25ug 25 µg

Recombinant Human N6AMT2 Protein - (Dry Ice)

Sign In for Pricing
View Details
WDR40A Rabbit Polyclonal Antibody (Center)
E28PB1484 100 µL

WDR40A Rabbit Polyclonal Antibody (Center)

Sign In for Pricing
View Details
HBP1 Polyclonal Antibody
MBS2537076-01 0.02 mL

HBP1 Polyclonal Antibody

Sign In for Pricing
View Details