Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lgi2 Peptide - middle region

Lgi2 Peptide - middle region

Product Specifications

Product Name Alternative

MKIAA1916

UniProt

Q8K4Z0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lgi2 Rabbit Polyclonal Antibody (orb580044) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659194

Preservative

Lyophilized powder

AA Sequence

PPEYQEKKLNEVTSFDYECTTTGPQTDEAKQRGWQLELSLGFCELIFVFQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ACCN1 Antibody [Alexa Fluor 405]
NB100-2531AF405 0.1 mL

Rabbit Polyclonal ACCN1 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
Caspase-3 Mouse Monoclonal Antibody (Fluoro488)
orb3085964 100 µg

Caspase-3 Mouse Monoclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
I830012O16Rik Double Nickase Plasmid (m)
sc-437121-NIC 20 µg

I830012O16Rik Double Nickase Plasmid (m)

Sign In for Pricing
View Details
NOTCH3 (NM_000435) Human Mutant ORF Clone
RC402106 10 µg

NOTCH3 (NM_000435) Human Mutant ORF Clone

Sign In for Pricing
View Details
Occludin (FITC) (MaxLight 490) discontinued
O5203-ML490 100 µL

Occludin (FITC) (MaxLight 490) discontinued

Sign In for Pricing
View Details
UCP1 antibody
MBS535346-01 0.1 mg

UCP1 antibody

Sign In for Pricing
View Details