LHPP Peptide - middle region
LHPP Peptide - middle region
Product Specifications
Product Name Alternative
MGC117251, MGC142189, MGC142191, HDHD2B
UniProt
Q9H008
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LHPP Rabbit Polyclonal Antibody (orb326217) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_071409
Preservative
Lyophilized powder
AA Sequence
ACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LCA38911-01 100 mg
5- (2-Chloroacetamido) benzene-1,3-dicarboxylic acid
Sign In for Pricing
View Details LCA38911-02 1 g
5- (2-Chloroacetamido) benzene-1,3-dicarboxylic acid
Sign In for Pricing
View Details MBS1091836-01 0.02 mg (E-Coli)
Recombinant Desulfovibrio vulgaris Phosphoglucosamine mutase (glmM)
Sign In for Pricing
View Details