Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lhx5 Peptide - middle region

Lhx5 Peptide - middle region

Product Specifications

Product Name Alternative

Lim2

UniProt

P61375

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lhx5 Rabbit Polyclonal Antibody (orb576144) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032525

Preservative

Lyophilized powder

AA Sequence

FFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQSDYYAPGGNYDFFAHGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carboxypeptidase A2 (CPA2) Human siRNA Oligo Duplex (Locus ID 1358)
SR300951 1 Kit

Carboxypeptidase A2 (CPA2) Human siRNA Oligo Duplex (Locus ID 1358)

Sign In for Pricing
View Details
TGFβ2 Polyclonal Conjugated Antibody
C41495 100 µL

TGFβ2 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Mouse CCDC53 shRNA Plasmid
abx976076-01 150 µg

Mouse CCDC53 shRNA Plasmid

Sign In for Pricing
View Details
Mouse CCDC53 shRNA Plasmid
abx976076-02 300 µg

Mouse CCDC53 shRNA Plasmid

Sign In for Pricing
View Details
Monoisohexyl Phthalate
TRC-M547800-1G 1 g

Monoisohexyl Phthalate

Sign In for Pricing
View Details
Anti-ERAP2 Antibody
A04269 0.1 mg

Anti-ERAP2 Antibody

Sign In for Pricing
View Details