Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lhx8 Peptide - N-terminal region

Lhx8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

L3, Lhx7

UniProt

O35652

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lhx8 Rabbit Polyclonal Antibody (orb576206) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034843

Preservative

Lyophilized powder

AA Sequence

AGEEGLVNPEGAGDEDSCSSSAPLSPSSSPQSMASGSVCPPGKCVCSSCG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Air Cooled Chiller BCHI-106
BCHI-106 Each

Air Cooled Chiller BCHI-106

Sign In for Pricing
View Details
Monopropylheptylphthalate 6-Hydroxy-d4
TRC-M567077-10MG 10 mg

Monopropylheptylphthalate 6-Hydroxy-d4

Sign In for Pricing
View Details
SIGLEC15 Mouse Monoclonal Antibody [Clone ID: OTI11G6]
CF815410 100 µg

SIGLEC15 Mouse Monoclonal Antibody [Clone ID: OTI11G6]

Sign In for Pricing
View Details
STAT3 / Signal Transducer and Activator of Transcription 3 (STAT3/2409), CF740 conjugate, 0.1mg/mL
BNC742409-500 1x 500 µL

STAT3 / Signal Transducer and Activator of Transcription 3 (STAT3/2409), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Synaptotagmin (Ab-309) Antibody
8B0032-AAT 50 µg

Synaptotagmin (Ab-309) Antibody

Sign In for Pricing
View Details
MIR4661 Human qPCR Primer Pair (MI0017289)
HP301055 200 Reactions

MIR4661 Human qPCR Primer Pair (MI0017289)

Sign In for Pricing
View Details