Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lhx8 Peptide - N-terminal region

Lhx8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

L3, Lhx7

UniProt

O35652

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lhx8 Rabbit Polyclonal Antibody (orb576206) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034843

Preservative

Lyophilized powder

AA Sequence

AGEEGLVNPEGAGDEDSCSSSAPLSPSSSPQSMASGSVCPPGKCVCSSCG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trypan Blue, sodium salt *10 mM aqueous solution*
2453-AAT 10 mL

Trypan Blue, sodium salt *10 mM aqueous solution*

Sign In for Pricing
View Details
General Purpose Oven BOGP-206
BOGP-206 1 Unit

General Purpose Oven BOGP-206

Sign In for Pricing
View Details
Frozen Tissue Sections, Urinary bladder
CS636361 5x 5 µm

Frozen Tissue Sections, Urinary bladder

Sign In for Pricing
View Details
Cullin 1 (CUL1) Rabbit Polyclonal Antibody
AP06077PU-N 100 µg

Cullin 1 (CUL1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Cat Eye Syndrome Chromosome Region, Candidate 1 (CECR1) ELISA Kit
RDR-CECR1-Hu-01 96 Tests

Human Cat Eye Syndrome Chromosome Region, Candidate 1 (CECR1) ELISA Kit

Sign In for Pricing
View Details
Human Cat Eye Syndrome Chromosome Region, Candidate 1 (CECR1) ELISA Kit
RDR-CECR1-Hu-02 48 Tests

Human Cat Eye Syndrome Chromosome Region, Candidate 1 (CECR1) ELISA Kit

Sign In for Pricing
View Details