Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIG1 Peptide - middle region

LIG1 Peptide - middle region

Product Specifications

Product Name Alternative

MGC117397, MGC130025

UniProt

P18858

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LIG1 Rabbit Polyclonal Antibody (orb582279) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000225

Preservative

Lyophilized powder

AA Sequence

PSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-CMV-SLC24A2-3xFLAG-CopGFP-Puro Plasmid
PVT66522 2 µg

PLV3-CMV-SLC24A2-3xFLAG-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
[Ile7]-Angiotensin III
CCP1009-01 1 mg

[Ile7]-Angiotensin III

Sign In for Pricing
View Details
[Ile7]-Angiotensin III
CCP1009-02 5 mg

[Ile7]-Angiotensin III

Sign In for Pricing
View Details
[Ile7]-Angiotensin III
CCP1009-03 10 mg

[Ile7]-Angiotensin III

Sign In for Pricing
View Details
TAS2R62P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV750029 1.0 µg DNA

TAS2R62P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ENAM Protein Vector (Mouse) (pPM-C-HA)
PV175616 500 ng

ENAM Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details