LIG1 Peptide - middle region
LIG1 Peptide - middle region
Product Specifications
Product Name Alternative
MGC117397, MGC130025
UniProt
P18858
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LIG1 Rabbit Polyclonal Antibody (orb582279) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_000225
Preservative
Lyophilized powder
AA Sequence
PSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1195930-01 0.02 mg (E-Coli)
Recombinant Proteus mirabilis Ribonuclease P protein component (rnpA)
Sign In for Pricing
View Details MBS1195930-02 0.1 mg (E-Coli)
Recombinant Proteus mirabilis Ribonuclease P protein component (rnpA)
Sign In for Pricing
View Details MBS1195930-03 0.02 mg (Yeast)
Recombinant Proteus mirabilis Ribonuclease P protein component (rnpA)
Sign In for Pricing
View Details MBS1195930-04 0.1 mg (Yeast)
Recombinant Proteus mirabilis Ribonuclease P protein component (rnpA)
Sign In for Pricing
View Details MBS1195930-05 0.02 mg (Baculovirus)
Recombinant Proteus mirabilis Ribonuclease P protein component (rnpA)
Sign In for Pricing
View Details MBS1195930-06 1 mg (E-Coli)
Recombinant Proteus mirabilis Ribonuclease P protein component (rnpA)
Sign In for Pricing
View Details