Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lig3 Peptide - C-terminal region

Lig3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

D11Wsu78e, MGC78176

UniProt

Q80ZH7

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lig3 Rabbit Polyclonal Antibody (orb582570) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034846

Preservative

Lyophilized powder

AA Sequence

TPCLKKVLLDVFTGVRLYLPPSTPDFKRLKRYFVAFDGDLVQEFDMGSAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Vein
CS806674 5x 5 µm

Tissue FFPE Sections, Vein

Sign In for Pricing
View Details
TPTE (NM_199259) Human Recombinant Protein
TP306018 20 µg

TPTE (NM_199259) Human Recombinant Protein

Sign In for Pricing
View Details
CD4 (T-Helper/Inducer Cell Marker) (CD4/1604), CF594 conjugate, 0.1mg/mL
BNC941604-100 1x 100 µL

CD4 (T-Helper/Inducer Cell Marker) (CD4/1604), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BID (BH3 Domain) Rabbit Polyclonal Antibody
AP11299PU-N 400 µL

BID (BH3 Domain) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
10X ViBuffer S, 5 x 1ml
RB0203 5x 1 mL

10X ViBuffer S, 5 x 1ml

Sign In for Pricing
View Details
Biotin Rat IgG1, κ Isotype Control[HRPN]
E-AB-F09823B-01 25 µg

Biotin Rat IgG1, κ Isotype Control[HRPN]

Sign In for Pricing
View Details