Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lig3 Peptide - C-terminal region

Lig3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

D11Wsu78e, MGC78176

UniProt

Q80ZH7

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lig3 Rabbit Polyclonal Antibody (orb582570) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034846

Preservative

Lyophilized powder

AA Sequence

TPCLKKVLLDVFTGVRLYLPPSTPDFKRLKRYFVAFDGDLVQEFDMGSAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROM1 (NM_000327) Human Over-expression Lysate
LC424795 20 µg

ROM1 (NM_000327) Human Over-expression Lysate

Sign In for Pricing
View Details
Leprot (NM_175036) Mouse Tagged ORF Clone
MG200755 10 µg

Leprot (NM_175036) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Vertical Autoclave BAVT-603-B
BAVT-603-B 1 Unit

Vertical Autoclave BAVT-603-B

Sign In for Pricing
View Details
Mouse Yipf7 activation kit by CRISPRa
GA210272 1 Kit

Mouse Yipf7 activation kit by CRISPRa

Sign In for Pricing
View Details
CLBA1 Human Gene Knockout Kit (CRISPR)
KN424353 1 Kit

CLBA1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PacBlue succinimidyl ester [equivalent to Pacific Blue succinimidyl ester]
570-AAT 5 mg

PacBlue succinimidyl ester [equivalent to Pacific Blue succinimidyl ester]

Sign In for Pricing
View Details