Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIPA Peptide - N-terminal region

LIPA Peptide - N-terminal region

Product Specifications

Product Name Alternative

CESD, LAL

UniProt

P38571

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LIPA Rabbit Polyclonal Antibody (orb326386) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000226

Preservative

Lyophilized powder

AA Sequence

SYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLAD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM-cAMP PDE IV substrate *Green Fluorescence*
13602-AAT 0.5 µmol

FAM-cAMP PDE IV substrate *Green Fluorescence*

Sign In for Pricing
View Details
Asb7 Mouse Gene Knockout Kit (CRISPR)
KN501662 1 Kit

Asb7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant PRXL2B Antibody
RC-6867-01 50 μL

Recombinant PRXL2B Antibody

Sign In for Pricing
View Details
Recombinant PRXL2B Antibody
RC-6867-02 100 µL

Recombinant PRXL2B Antibody

Sign In for Pricing
View Details
Recombinant PRXL2B Antibody
RC-6867-03 1 mL

Recombinant PRXL2B Antibody

Sign In for Pricing
View Details
USH1C Antibody
KC-2306-01 50 μL

USH1C Antibody

Sign In for Pricing
View Details