Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIPC Peptide - C-terminal region

LIPC Peptide - C-terminal region

Product Specifications

Product Name Alternative

HDLCQ12, HL, HTGL, LIPH

UniProt

P11150

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LIPC Rabbit Polyclonal Antibody (orb585650) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000227

Preservative

Lyophilized powder

AA Sequence

GDMNSFSQGLCLSCKKGRCNTLGYHVRQEPRSKSKRLFLVTRAQSPFKVY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Prohibitin ELISA kit
GTR10475671 96 Well

Monkey Prohibitin ELISA kit

Sign In for Pricing
View Details
Human MTMR6 Pre-designed siRNA Set A
SI010000A 1 Each

Human MTMR6 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Inadl 3'UTR Lenti-reporter-Luc Vector
24953084 1.0 µg

Inadl 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
SLC32A1 Human qPCR Template Standard (NM_080552)
HK211571 1 Kit

SLC32A1 Human qPCR Template Standard (NM_080552)

Sign In for Pricing
View Details
Human Apoptosis-related Factor (FAS; CD95) ELISA Kit
JL12967-01 48 Tests

Human Apoptosis-related Factor (FAS; CD95) ELISA Kit

Sign In for Pricing
View Details
Human Apoptosis-related Factor (FAS; CD95) ELISA Kit
JL12967-02 96 Tests

Human Apoptosis-related Factor (FAS; CD95) ELISA Kit

Sign In for Pricing
View Details