Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIPC Peptide - C-terminal region

LIPC Peptide - C-terminal region

Product Specifications

Product Name Alternative

HDLCQ12, HL, HTGL, LIPH

UniProt

P11150

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LIPC Rabbit Polyclonal Antibody (orb585650) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000227

Preservative

Lyophilized powder

AA Sequence

GDMNSFSQGLCLSCKKGRCNTLGYHVRQEPRSKSKRLFLVTRAQSPFKVY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-9, Recombinant, Human (Interleukin-9, IL-9, IL9, Cytokine P40, HP40, P40, T-cell Growth Factor P40) discontinued
219966 10 µg

IL-9, Recombinant, Human (Interleukin-9, IL-9, IL9, Cytokine P40, HP40, P40, T-cell Growth Factor P40) discontinued

Sign In for Pricing
View Details
OR5D18 3'UTR Luciferase Stable Cell Line
TU016632 1.0 mL

OR5D18 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PLV3-U6-CAPN8-shRNA1-CopGFP-Puro Plasmid
PVT80317 2 µg

PLV3-U6-CAPN8-shRNA1-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Donkey Anti-Human IgG Antibody (H+L), PE Conjugated
bs-0297D-PE 200 µL

Donkey Anti-Human IgG Antibody (H+L), PE Conjugated

Sign In for Pricing
View Details
Griffonia simplicifolia Lectin (GSL I+II) - HRP (Horseradish Peroxidase)
21510921-1 2 mg

Griffonia simplicifolia Lectin (GSL I+II) - HRP (Horseradish Peroxidase)

Sign In for Pricing
View Details
CD45 Rabbit Polyclonal Antibody
orb182920-01 50 μL

CD45 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details