Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIPI Peptide - middle region

LIPI Peptide - middle region

Product Specifications

Product Name Alternative

LPDL, PRED5, CT17

UniProt

Q6XZB0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LIPI Rabbit Polyclonal Antibody (orb579614) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_945347

Preservative

Lyophilized powder

AA Sequence

YFVLSIIVPDKTMMDGSFSFKLLNQLGMIEEPRLYEKNKPFYKLQEVKIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIC 324-F-A4-B7541 AC Signs
808699 Card of 1 Pictogram(s)

PIC 324-F-A4-B7541 AC Signs

Sign In for Pricing
View Details
Monkey Alpha-2-Heremans Schmid Glycoprotein (AHSG) Protein
abx652475-01 100 µg

Monkey Alpha-2-Heremans Schmid Glycoprotein (AHSG) Protein

Sign In for Pricing
View Details
Monkey Alpha-2-Heremans Schmid Glycoprotein (AHSG) Protein
abx652475-02 200 µg

Monkey Alpha-2-Heremans Schmid Glycoprotein (AHSG) Protein

Sign In for Pricing
View Details
Monkey Alpha-2-Heremans Schmid Glycoprotein (AHSG) Protein
abx652475-03 500 µg

Monkey Alpha-2-Heremans Schmid Glycoprotein (AHSG) Protein

Sign In for Pricing
View Details
Monkey Alpha-2-Heremans Schmid Glycoprotein (AHSG) Protein
abx652475-04 1 mg

Monkey Alpha-2-Heremans Schmid Glycoprotein (AHSG) Protein

Sign In for Pricing
View Details
pCMV-SPORT6-ERI2 Plasmid
PVT13598 2 µg

pCMV-SPORT6-ERI2 Plasmid

Sign In for Pricing
View Details