Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lmod1 Peptide - C-terminal region

Lmod1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

9530015K06Rik, SM-Lmod

UniProt

Q8BVA4

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lmod1 Rabbit Polyclonal Antibody (orb582516) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_444336

Preservative

Lyophilized powder

AA Sequence

LAPPLIMENLKNSLSPATQRKMGDKVLPAQEKNSRDQLLAAIRSSNLKQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFAND1 Human qPCR Primer Pair (NM_024699)
HP214967 200 Reactions

ZFAND1 Human qPCR Primer Pair (NM_024699)

Sign In for Pricing
View Details
Porcine Mannose Binding Lectin ELISA Kit
MBS058783-01 48 Well

Porcine Mannose Binding Lectin ELISA Kit

Sign In for Pricing
View Details
Porcine Mannose Binding Lectin ELISA Kit
MBS058783-02 96 Well

Porcine Mannose Binding Lectin ELISA Kit

Sign In for Pricing
View Details
Porcine Mannose Binding Lectin ELISA Kit
MBS058783-03 5x 96 Well

Porcine Mannose Binding Lectin ELISA Kit

Sign In for Pricing
View Details
Porcine Mannose Binding Lectin ELISA Kit
MBS058783-04 10x 96 Well

Porcine Mannose Binding Lectin ELISA Kit

Sign In for Pricing
View Details
Bixafen
CS-EE-00031 1 Each

Bixafen

Sign In for Pricing
View Details