Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lmod1 Peptide - C-terminal region

Lmod1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

9530015K06Rik, SM-Lmod

UniProt

Q8BVA4

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lmod1 Rabbit Polyclonal Antibody (orb582516) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_444336

Preservative

Lyophilized powder

AA Sequence

LAPPLIMENLKNSLSPATQRKMGDKVLPAQEKNSRDQLLAAIRSSNLKQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-human CD4-FITC
MBS666711-01 120 Tests

anti-human CD4-FITC

Sign In for Pricing
View Details
anti-human CD4-FITC
MBS666711-02 5x 120 Tests

anti-human CD4-FITC

Sign In for Pricing
View Details
CD36 (1E8), CF568 conjugate, 0.1mg/mL
BNC680314-100 1x 100 µL

CD36 (1E8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rabbit Polyclonal IL-13 Antibody
NBP3-11366-0.1mg 0.1 mg

Rabbit Polyclonal IL-13 Antibody

Sign In for Pricing
View Details
MAPK8 antibody
MBS838028-01 0.1 mL

MAPK8 antibody

Sign In for Pricing
View Details
MAPK8 antibody
MBS838028-02 5x 0.1 mL

MAPK8 antibody

Sign In for Pricing
View Details