Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lmx1a Peptide - middle region

Lmx1a Peptide - middle region

Product Specifications

Product Name Alternative

Lmx1.1, MGC129356, MGC129357, dr, dreher, sst

UniProt

Q9JKU8

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lmx1a Rabbit Polyclonal Antibody (orb576304) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_387501

Preservative

Lyophilized powder

AA Sequence

KKLARRQQQQQQDQQNTQRLTSAQTNGSGNAGMEGIMNPYTTLPTPQQLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADORA2A Antibody
8G020-AAT 50 µg

ADORA2A Antibody

Sign In for Pricing
View Details
MEK3 (MAP2K3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G3]
TA505890AM 100 µL

MEK3 (MAP2K3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G3]

Sign In for Pricing
View Details
NRSN2 Human Gene Knockout Kit (CRISPR)
KN419843 1 Kit

NRSN2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human HK2 Protein (Trx Tag)
PDEH100629-01 20 µg

Recombinant Human HK2 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human HK2 Protein (Trx Tag)
PDEH100629-02 100 µg

Recombinant Human HK2 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human HK2 Protein (Trx Tag)
PDEH100629-03 500 µg

Recombinant Human HK2 Protein (Trx Tag)

Sign In for Pricing
View Details