Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lmx1a Peptide - middle region

Lmx1a Peptide - middle region

Product Specifications

Product Name Alternative

Lmx1.1, MGC129356, MGC129357, dr, dreher, sst

UniProt

Q9JKU8

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lmx1a Rabbit Polyclonal Antibody (orb576304) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_387501

Preservative

Lyophilized powder

AA Sequence

KKLARRQQQQQQDQQNTQRLTSAQTNGSGNAGMEGIMNPYTTLPTPQQLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TF4-VAD-FMK
13471-AAT 25 Tests

TF4-VAD-FMK

Sign In for Pricing
View Details
Pdrg1 (NM_178939) Mouse Tagged ORF Clone
MG200777 10 µg

Pdrg1 (NM_178939) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
(3aR,4R,5R,6aS)-4-[3-(Ethyleneketal)decanyl]hexahydro-5-hydroxy-2H-cyclopenta[b]furan-2-one-d15
TRC-E917787-10MG 10 mg

(3aR,4R,5R,6aS)-4-[3-(Ethyleneketal)decanyl]hexahydro-5-hydroxy-2H-cyclopenta[b]furan-2-one-d15

Sign In for Pricing
View Details
PSMC1 Polyclonal Antibody
E-AB-11500-01 20 µL

PSMC1 Polyclonal Antibody

Sign In for Pricing
View Details
PSMC1 Polyclonal Antibody
E-AB-11500-02 60 µL

PSMC1 Polyclonal Antibody

Sign In for Pricing
View Details
PSMC1 Polyclonal Antibody
E-AB-11500-03 120 µL

PSMC1 Polyclonal Antibody

Sign In for Pricing
View Details