Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEMO1 Peptide - N-terminal region

MEMO1 Peptide - N-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MEMO1 Rabbit Polyclonal Antibody (orb325248) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_001479172

Preservative

Lyophilized powder

AA Sequence

SGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OSM (Oncostatin M) ELISA Kit
E-EL-H2247-01 24 Tests

Human OSM (Oncostatin M) ELISA Kit

Sign In for Pricing
View Details
Human OSM (Oncostatin M) ELISA Kit
E-EL-H2247-02 48 Tests

Human OSM (Oncostatin M) ELISA Kit

Sign In for Pricing
View Details
Human OSM (Oncostatin M) ELISA Kit
E-EL-H2247-03 96 Tests

Human OSM (Oncostatin M) ELISA Kit

Sign In for Pricing
View Details
Biotin Conjugated Goat Polyclonal Antibody to Rabbit IgG,
BA-2307-2 2 mL

Biotin Conjugated Goat Polyclonal Antibody to Rabbit IgG,

Sign In for Pricing
View Details
GRK4 Mouse Monoclonal Antibody [Clone ID: OTI4F5]
CF805974 100 µg

GRK4 Mouse Monoclonal Antibody [Clone ID: OTI4F5]

Sign In for Pricing
View Details
HLAA (HLA-A) Human Gene Knockout Kit (CRISPR)
KN400661 1 Kit

HLAA (HLA-A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details