Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEMO1 Peptide - N-terminal region

MEMO1 Peptide - N-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MEMO1 Rabbit Polyclonal Antibody (orb325248) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_001479172

Preservative

Lyophilized powder

AA Sequence

SGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMD8 Human Gene Knockout Kit (CRISPR)
KN400436 1 Kit

PSMD8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bestrophin 3 (BEST3) (NM_001282616) Human Tagged ORF Clone
RG235461 10 µg

Bestrophin 3 (BEST3) (NM_001282616) Human Tagged ORF Clone

Sign In for Pricing
View Details
1,5-Diazido-3-oxapentane
TRC-D417280-500MG 500 mg

1,5-Diazido-3-oxapentane

Sign In for Pricing
View Details
Human ATP6V0E2 activation kit by CRISPRa
GA115910 1 Kit

Human ATP6V0E2 activation kit by CRISPRa

Sign In for Pricing
View Details
3-Chloro-1-indan-5-yl-propan-1-one
TRC-C366970-250MG 250 mg

3-Chloro-1-indan-5-yl-propan-1-one

Sign In for Pricing
View Details
Optitrol SeroNeg
SR11002 2x 5 mL

Optitrol SeroNeg

Sign In for Pricing
View Details