LOC100360413 Peptide - middle region
LOC100360413 Peptide - middle region
Product Specifications
Product Name Alternative
C20orf25, dJ998H6.1
UniProt
Q9UJ99
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LOC100360413 Rabbit Polyclonal Antibody (orb325387) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
EAW75754
Preservative
Lyophilized powder
AA Sequence
GQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![2'- (((tert-Butoxycarbonyl) amino) methyl) -3,3''-dihydroxy-[1,1':4',1''-terphenyl]-4,4''-dicarboxylic acid](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
OR1052894-01 50 mg
2'- (((tert-Butoxycarbonyl) amino) methyl) -3,3''-dihydroxy-[1,1':4',1''-terphenyl]-4,4''-dicarboxylic acid
Sign In for Pricing
View Details OR1052894-02 100 mg
2'- (((tert-Butoxycarbonyl) amino) methyl) -3,3''-dihydroxy-[1,1':4',1''-terphenyl]-4,4''-dicarboxylic acid
Sign In for Pricing
View Details OR1052894-03 250 mg
2'- (((tert-Butoxycarbonyl) amino) methyl) -3,3''-dihydroxy-[1,1':4',1''-terphenyl]-4,4''-dicarboxylic acid
Sign In for Pricing
View Details 
MBS2077047-01 0.1 mL
APC-Linked Polyclonal Antibody to Peptidyl Arginine Deiminase Type III (PADI3)
Sign In for Pricing
View Details MBS2077047-02 0.2 mL
APC-Linked Polyclonal Antibody to Peptidyl Arginine Deiminase Type III (PADI3)
Sign In for Pricing
View Details MBS2077047-03 0.5 mL
APC-Linked Polyclonal Antibody to Peptidyl Arginine Deiminase Type III (PADI3)
Sign In for Pricing
View Details