Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LOC100364462 Peptide - middle region

LOC100364462 Peptide - middle region

Product Specifications

Product Name Alternative

LOC100364462

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

XP_002724704

Preservative

Lyophilized powder

AA Sequence

LIPLHAAPNQAVAEIDALYDVYLDVIDKWNTDDMLFLGDFNADCKYVKAH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alkaline Phosphatase Conjugated Rabbit Anti-Con A Antibody
AAL-1104-1 1 mL

Alkaline Phosphatase Conjugated Rabbit Anti-Con A Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Esophagus
CS500989 5x 5 µm

Frozen Tissue Sections, Esophagus

Sign In for Pricing
View Details
LATS1 Antibody
KC-3838-01 50 μL

LATS1 Antibody

Sign In for Pricing
View Details
LATS1 Antibody
KC-3838-02 100 µL

LATS1 Antibody

Sign In for Pricing
View Details
LATS1 Antibody
KC-3838-03 1 mL

LATS1 Antibody

Sign In for Pricing
View Details
Biotin Anti-Human CD235 Antibody
RD20925F-01 25 µg

Biotin Anti-Human CD235 Antibody

Sign In for Pricing
View Details